HSF2 monoclonal antibody (M01), clone 1F11-A3 View larger

HSF2 monoclonal antibody (M01), clone 1F11-A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSF2 monoclonal antibody (M01), clone 1F11-A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about HSF2 monoclonal antibody (M01), clone 1F11-A3

Brand: Abnova
Reference: H00003298-M01
Product name: HSF2 monoclonal antibody (M01), clone 1F11-A3
Product description: Mouse monoclonal antibody raised against a full length recombinant HSF2.
Clone: 1F11-A3
Isotype: IgG1 kappa
Gene id: 3298
Gene name: HSF2
Gene alias: MGC117376|MGC156196|MGC75048
Gene description: heat shock transcription factor 2
Genbank accession: BC005329
Immunogen: HSF2 (AAH05329, 1 a.a. ~ 230 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF
Protein accession: AAH05329
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003298-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (51.04 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003298-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged HSF2 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HSF2 monoclonal antibody (M01), clone 1F11-A3 now

Add to cart