HSF1 monoclonal antibody (M09), clone 1A11 View larger

HSF1 monoclonal antibody (M09), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSF1 monoclonal antibody (M09), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about HSF1 monoclonal antibody (M09), clone 1A11

Brand: Abnova
Reference: H00003297-M09
Product name: HSF1 monoclonal antibody (M09), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant HSF1.
Clone: 1A11
Isotype: IgG2a Kappa
Gene id: 3297
Gene name: HSF1
Gene alias: HSTF1
Gene description: heat shock transcription factor 1
Genbank accession: NM_005526
Immunogen: HSF1 (NP_005517.1, 256 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEG
Protein accession: NP_005517.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003297-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003297-M09-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged HSF1 is 3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HSF1 monoclonal antibody (M09), clone 1A11 now

Add to cart