Cart 129 Product Products 25 634,50 € (empty)
-
-
-
-
1 x Lambda 5...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x LARG...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Cdk8...259,07 € -
-
-
-
1 x MPP9...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Cdk2/Cdc2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CD300d...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
25 634,50 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 129 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 25 634,50 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 25 634,50 €
Data sheet of HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00003294-D01P |
| Product name: | HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human HSD17B2 protein. |
| Gene id: | 3294 |
| Gene name: | HSD17B2 |
| Gene alias: | EDH17B2|HSD17|SDR9C2 |
| Gene description: | hydroxysteroid (17-beta) dehydrogenase 2 |
| Genbank accession: | NM_002153.1 |
| Immunogen: | HSD17B2 (NP_002144.1, 1 a.a. ~ 387 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT |
| Protein accession: | NP_002144.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | HSD17B2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in human liver. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |