HSD17B2 purified MaxPab mouse polyclonal antibody (B01P) View larger

HSD17B2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSD17B2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about HSD17B2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00003294-B01P
Product name: HSD17B2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human HSD17B2 protein.
Gene id: 3294
Gene name: HSD17B2
Gene alias: EDH17B2|HSD17|SDR9C2
Gene description: hydroxysteroid (17-beta) dehydrogenase 2
Genbank accession: BC009581
Immunogen: HSD17B2 (AAH09581, 1 a.a. ~ 387 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
Protein accession: AAH09581
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003294-B01P-13-15-1.jpg
Application image note: Western Blot analysis of HSD17B2 expression in transfected 293T cell line (H00003294-T01) by HSD17B2 MaxPab polyclonal antibody.

Lane 1: HSD17B2 transfected lysate(42.68 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HSD17B2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart