Brand: | Abnova |
Reference: | H00003292-M03 |
Product name: | HSD17B1 monoclonal antibody (M03), clone 2E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HSD17B1. |
Clone: | 2E5 |
Isotype: | IgG1 Kappa |
Gene id: | 3292 |
Gene name: | HSD17B1 |
Gene alias: | EDH17B2|EDHB17|HSD17|MGC138140|SDR28C1 |
Gene description: | hydroxysteroid (17-beta) dehydrogenase 1 |
Genbank accession: | NM_000413 |
Immunogen: | HSD17B1 (NP_000404, 189 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF |
Protein accession: | NP_000404 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to HSD17B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The role of estrogen-metabolizing enzymes and estrogen receptors in human epidermis.Inoue T, Miki Y, Abe K, Hatori M, Hosaka M, Kariya Y, Kakuo S, Fujimura T, Hachiya A, Aiba S, Sasano H. Mol Cell Endocrinol. 2011 Jun 29. [Epub ahead of print] |