HSD17B1 monoclonal antibody (M03), clone 2E5 View larger

HSD17B1 monoclonal antibody (M03), clone 2E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSD17B1 monoclonal antibody (M03), clone 2E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about HSD17B1 monoclonal antibody (M03), clone 2E5

Brand: Abnova
Reference: H00003292-M03
Product name: HSD17B1 monoclonal antibody (M03), clone 2E5
Product description: Mouse monoclonal antibody raised against a partial recombinant HSD17B1.
Clone: 2E5
Isotype: IgG1 Kappa
Gene id: 3292
Gene name: HSD17B1
Gene alias: EDH17B2|EDHB17|HSD17|MGC138140|SDR28C1
Gene description: hydroxysteroid (17-beta) dehydrogenase 1
Genbank accession: NM_000413
Immunogen: HSD17B1 (NP_000404, 189 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF
Protein accession: NP_000404
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003292-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003292-M03-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to HSD17B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: The role of estrogen-metabolizing enzymes and estrogen receptors in human epidermis.Inoue T, Miki Y, Abe K, Hatori M, Hosaka M, Kariya Y, Kakuo S, Fujimura T, Hachiya A, Aiba S, Sasano H.
Mol Cell Endocrinol. 2011 Jun 29. [Epub ahead of print]

Reviews

Buy HSD17B1 monoclonal antibody (M03), clone 2E5 now

Add to cart