Brand: | Abnova |
Reference: | H00003290-M02A |
Product name: | HSD11B1 monoclonal antibody (M02A), clone 2C10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HSD11B1. |
Clone: | 2C10 |
Isotype: | IgM Kappa |
Gene id: | 3290 |
Gene name: | HSD11B1 |
Gene alias: | 11-DH|11-beta-HSD1|HDL|HSD11|HSD11B|HSD11L|MGC13539|SDR26C1 |
Gene description: | hydroxysteroid (11-beta) dehydrogenase 1 |
Genbank accession: | BC012593 |
Immunogen: | HSD11B1 (AAH12593, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK |
Protein accession: | AAH12593 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (57.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HSD11B1 monoclonal antibody (M02A), clone 2C10. Western Blot analysis of HSD11B1 expression in MCF-7. |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |