HSD11B1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

HSD11B1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSD11B1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about HSD11B1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003290-D01P
Product name: HSD11B1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human HSD11B1 protein.
Gene id: 3290
Gene name: HSD11B1
Gene alias: 11-DH|11-beta-HSD1|HDL|HSD11|HSD11B|HSD11L|MGC13539|SDR26C1
Gene description: hydroxysteroid (11-beta) dehydrogenase 1
Genbank accession: NM_005525.2
Immunogen: HSD11B1 (NP_005516.1, 1 a.a. ~ 292 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Protein accession: NP_005516.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003290-D01P-13-15-1.jpg
Application image note: Western Blot analysis of HSD11B1 expression in transfected 293T cell line (H00003290-T01) by HSD11B1 MaxPab polyclonal antibody.

Lane 1: HSD11B1 transfected lysate(32.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HSD11B1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart