Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003284-M02 |
Product name: | HSD3B2 monoclonal antibody (M02), clone 1E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HSD3B2. |
Clone: | 1E8 |
Isotype: | IgG2a Kappa |
Gene id: | 3284 |
Gene name: | HSD3B2 |
Gene alias: | HSDB|HSDB3|SDR11E2 |
Gene description: | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 |
Genbank accession: | NM_000198 |
Immunogen: | HSD3B2 (NP_000189.1, 33 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT |
Protein accession: | NP_000189.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HSD3B2 expression in transfected 293T cell line by HSD3B2 monoclonal antibody (M02), clone 1E8. Lane 1: HSD3B2 transfected lysate(42.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Pomegranate extracts impact the androgen biosynthesis pathways in prostate cancer models in vitro and in vivo.Ming DS, Pham S, Deb S, Chin MY, Kharmate G, Adomat H, Beheshti EH, Locke J, Guns ET J Steroid Biochem Mol Biol. 2014 Feb 22;143C:19-28. doi: 10.1016/j.jsbmb.2014.02.006. |