HSD3B2 monoclonal antibody (M02), clone 1E8 View larger

HSD3B2 monoclonal antibody (M02), clone 1E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSD3B2 monoclonal antibody (M02), clone 1E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about HSD3B2 monoclonal antibody (M02), clone 1E8

Brand: Abnova
Reference: H00003284-M02
Product name: HSD3B2 monoclonal antibody (M02), clone 1E8
Product description: Mouse monoclonal antibody raised against a partial recombinant HSD3B2.
Clone: 1E8
Isotype: IgG2a Kappa
Gene id: 3284
Gene name: HSD3B2
Gene alias: HSDB|HSDB3|SDR11E2
Gene description: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
Genbank accession: NM_000198
Immunogen: HSD3B2 (NP_000189.1, 33 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT
Protein accession: NP_000189.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003284-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003284-M02-13-15-1.jpg
Application image note: Western Blot analysis of HSD3B2 expression in transfected 293T cell line by HSD3B2 monoclonal antibody (M02), clone 1E8.

Lane 1: HSD3B2 transfected lysate(42.1 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Pomegranate extracts impact the androgen biosynthesis pathways in prostate cancer models in vitro and in vivo.Ming DS, Pham S, Deb S, Chin MY, Kharmate G, Adomat H, Beheshti EH, Locke J, Guns ET
J Steroid Biochem Mol Biol. 2014 Feb 22;143C:19-28. doi: 10.1016/j.jsbmb.2014.02.006.

Reviews

Buy HSD3B2 monoclonal antibody (M02), clone 1E8 now

Add to cart