HSD3B1 MaxPab mouse polyclonal antibody (B01) View larger

HSD3B1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSD3B1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about HSD3B1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00003283-B01
Product name: HSD3B1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human HSD3B1 protein.
Gene id: 3283
Gene name: HSD3B1
Gene alias: HSD3B|HSDB3|SDR11E1
Gene description: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Genbank accession: NM_000862.1
Immunogen: HSD3B1 (NP_000853.1, 1 a.a. ~ 373 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ
Protein accession: NP_000853.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003283-B01-13-15-1.jpg
Application image note: Western Blot analysis of HSD3B1 expression in transfected 293T cell line (H00003283-T01) by HSD3B1 MaxPab polyclonal antibody.

Lane 1: HSD3B1 transfected lysate(41.03 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HSD3B1 MaxPab mouse polyclonal antibody (B01) now

Add to cart