Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HES1 monoclonal antibody (M02), clone 3A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA |
More info about HES1 monoclonal antibody (M02), clone 3A3
| Brand: | Abnova |
| Reference: | H00003280-M02 |
| Product name: | HES1 monoclonal antibody (M02), clone 3A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HES1. |
| Clone: | 3A3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3280 |
| Gene name: | HES1 |
| Gene alias: | FLJ20408|HES-1|HHL|HRY|bHLHb39 |
| Gene description: | hairy and enhancer of split 1, (Drosophila) |
| Genbank accession: | NM_005524 |
| Immunogen: | HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH |
| Protein accession: | NP_005515 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to HES1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Inhibition of breast cancer cell survival by Xanthohumol via modulation of the Notch signaling pathway in vivo and in vitro.Sun Z, Zhou C, Liu F, Zhang W, Chen J, Pan Y, Ma L, Liu Q, Du Y, Yang J, Wang Q. Oncol Lett. 2018 Jan;15(1):908-916. doi: 10.3892/ol.2017.7434. Epub 2017 Nov 17. |