Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00003265-B01 |
Product name: | HRAS MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human HRAS protein. |
Gene id: | 3265 |
Gene name: | HRAS |
Gene alias: | C-BAS/HAS|C-H-RAS|C-HA-RAS1|CTLO|H-RASIDX|HAMSV|HRAS1|K-RAS|N-RAS|RASH1 |
Gene description: | v-Ha-ras Harvey rat sarcoma viral oncogene homolog |
Genbank accession: | NM_005343 |
Immunogen: | HRAS (NP_005334, 1 a.a. ~ 189 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS |
Protein accession: | NP_005334 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HRAS expression in transfected 293T cell line (H00003265-T02) by HRAS MaxPab polyclonal antibody. Lane 1: HRAS transfected lysate(20.79 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |