New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00003251-D01F |
Product name: | HPRT1 affinity purified MaxPab rabbit polyclonal antibody (D01F) |
Product description: | Rabbit polyclonal antibody raised against a full-length human HPRT1 protein. |
Gene id: | 3251 |
Gene name: | HPRT1 |
Gene alias: | HGPRT|HPRT |
Gene description: | hypoxanthine phosphoribosyltransferase 1 |
Genbank accession: | NM_000194.1 |
Immunogen: | HPRT1 (NP_000185.1, 1 a.a. ~ 218 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA |
Protein accession: | NP_000185.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HPRT1 expression in transfected 293T cell line (H00003251-T02) by HPRT1 MaxPab polyclonal antibody. Lane 1: HPRT1 transfected lysate(24.60 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |