Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HPRT1 affinity purified MaxPab rabbit polyclonal antibody (D01F)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about HPRT1 affinity purified MaxPab rabbit polyclonal antibody (D01F)
| Brand: | Abnova |
| Reference: | H00003251-D01F |
| Product name: | HPRT1 affinity purified MaxPab rabbit polyclonal antibody (D01F) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human HPRT1 protein. |
| Gene id: | 3251 |
| Gene name: | HPRT1 |
| Gene alias: | HGPRT|HPRT |
| Gene description: | hypoxanthine phosphoribosyltransferase 1 |
| Genbank accession: | NM_000194.1 |
| Immunogen: | HPRT1 (NP_000185.1, 1 a.a. ~ 218 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA |
| Protein accession: | NP_000185.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HPRT1 expression in transfected 293T cell line (H00003251-T02) by HPRT1 MaxPab polyclonal antibody. Lane 1: HPRT1 transfected lysate(24.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |