HOXB9 purified MaxPab rabbit polyclonal antibody (D03P) View larger

HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)

Brand: Abnova
Reference: H00003219-D03P
Product name: HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)
Product description: Rabbit polyclonal antibody raised against a full-length human HOXB9 protein.
Gene id: 3219
Gene name: HOXB9
Gene alias: HOX-2.5|HOX2|HOX2E
Gene description: homeobox B9
Genbank accession: NM_024017.4
Immunogen: HOXB9 (NP_076922.1, 1 a.a. ~ 250 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
Protein accession: NP_076922.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00003219-D03P-13-15-1.jpg
Application image note: Western Blot analysis of HOXB9 expression in transfected 293T cell line (H00003219-T01) by HOXB9 MaxPab polyclonal antibody.

Lane 1: HOXB9 transfected lysate(28.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HOXB9 purified MaxPab rabbit polyclonal antibody (D03P) now

Add to cart