Brand: | Abnova |
Reference: | H00003217-A01 |
Product name: | HOXB7 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HOXB7. |
Gene id: | 3217 |
Gene name: | HOXB7 |
Gene alias: | HHO.C1|HOX2|HOX2C|Hox-2.3 |
Gene description: | homeobox B7 |
Genbank accession: | NM_004502 |
Immunogen: | HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA |
Protein accession: | NP_004493 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |