HPCA purified MaxPab mouse polyclonal antibody (B01P) View larger

HPCA purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HPCA purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about HPCA purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00003208-B01P
Product name: HPCA purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human HPCA protein.
Gene id: 3208
Gene name: HPCA
Gene alias: BDR2
Gene description: hippocalcin
Genbank accession: NM_002143
Immunogen: HPCA (NP_002134, 1 a.a. ~ 193 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF
Protein accession: NP_002134
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003208-B01P-13-15-1.jpg
Application image note: Western Blot analysis of HPCA expression in transfected 293T cell line (H00003208-T01) by HPCA MaxPab polyclonal antibody.

Lane 1: HPCA transfected lysate(21.23 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HPCA purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart