HOXA11 monoclonal antibody (M04), clone 8E10 View larger

HOXA11 monoclonal antibody (M04), clone 8E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXA11 monoclonal antibody (M04), clone 8E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HOXA11 monoclonal antibody (M04), clone 8E10

Brand: Abnova
Reference: H00003207-M04
Product name: HOXA11 monoclonal antibody (M04), clone 8E10
Product description: Mouse monoclonal antibody raised against a partial recombinant HOXA11.
Clone: 8E10
Isotype: IgG2a Kappa
Gene id: 3207
Gene name: HOXA11
Gene alias: HOX1|HOX1I
Gene description: homeobox A11
Genbank accession: NM_005523
Immunogen: HOXA11 (NP_005514, 60 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAE
Protein accession: NP_005514
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003207-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003207-M04-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged HOXA11 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HOXA11 monoclonal antibody (M04), clone 8E10 now

Add to cart