Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HOXA7 monoclonal antibody (M01), clone 2F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about HOXA7 monoclonal antibody (M01), clone 2F2
| Brand: | Abnova |
| Reference: | H00003204-M01 |
| Product name: | HOXA7 monoclonal antibody (M01), clone 2F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXA7. |
| Clone: | 2F2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3204 |
| Gene name: | HOXA7 |
| Gene alias: | ANTP|HOX1|HOX1.1|HOX1A |
| Gene description: | homeobox A7 |
| Genbank accession: | NM_006896 |
| Immunogen: | HOXA7 (NP_008827, 58 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGA |
| Protein accession: | NP_008827 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.79 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HOXA7 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | HOX gene analysis of endothelial cell differentiation in human bone marrow-derived mesenchymal stem cells.Chung N, Jee BK, Chae SW, Jeon YW, Lee KH, Rha HK. Mol Biol Rep. 2009 Feb;36(2):227-35. Epub 2007 Oct 30. |