Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HOXA6 monoclonal antibody (M01), clone 3A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about HOXA6 monoclonal antibody (M01), clone 3A6
| Brand: | Abnova |
| Reference: | H00003203-M01 |
| Product name: | HOXA6 monoclonal antibody (M01), clone 3A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXA6. |
| Clone: | 3A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3203 |
| Gene name: | HOXA6 |
| Gene alias: | HOX1|HOX1.2|HOX1B |
| Gene description: | homeobox A6 |
| Genbank accession: | NM_024014 |
| Immunogen: | HOXA6 (NP_076919, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADR |
| Protein accession: | NP_076919 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HOXA6 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Leukemic fusion genes MLL/AF4 and AML1/MTG8 support leukemic self-renewal by controlling expression of the telomerase subunit TERT.Gessner A, Thomas M, Garrido Castro P, Buchler L, Scholz A, Brummendorf TH, Martinez Soria N, Vormoor J, Greil J, Heidenreich O. Leukemia. 2010 Aug 5. [Epub ahead of print] |