Brand: | Abnova |
Reference: | H00003202-M06 |
Product name: | HOXA5 monoclonal antibody (M06), clone 3C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXA5. |
Clone: | 3C2 |
Isotype: | IgG2b Kappa |
Gene id: | 3202 |
Gene name: | HOXA5 |
Gene alias: | HOX1|HOX1.3|HOX1C|MGC9376 |
Gene description: | homeobox A5 |
Genbank accession: | NM_019102.1 |
Immunogen: | HOXA5 (NP_061975.1, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP |
Protein accession: | NP_061975.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HOXA5 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Evaluating Serum Markers for Hormone Receptor-Negative Breast Cancer.Schummer M, Thorpe J, Giraldez M, Bergan L, Tewari M, Urban N. PLoS One. 2015 Nov 13;10(11):e0142911. |