HOXA5 monoclonal antibody (M04), clone 2C3 View larger

HOXA5 monoclonal antibody (M04), clone 2C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXA5 monoclonal antibody (M04), clone 2C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about HOXA5 monoclonal antibody (M04), clone 2C3

Brand: Abnova
Reference: H00003202-M04
Product name: HOXA5 monoclonal antibody (M04), clone 2C3
Product description: Mouse monoclonal antibody raised against a partial recombinant HOXA5.
Clone: 2C3
Isotype: IgG2a Kappa
Gene id: 3202
Gene name: HOXA5
Gene alias: HOX1|HOX1.3|HOX1C|MGC9376
Gene description: homeobox A5
Genbank accession: NM_019102.1
Immunogen: HOXA5 (NP_061975.1, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP
Protein accession: NP_061975.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003202-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003202-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged HOXA5 is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HOXA5 monoclonal antibody (M04), clone 2C3 now

Add to cart