HOXA4 purified MaxPab mouse polyclonal antibody (B01P) View larger

HOXA4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXA4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about HOXA4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00003201-B01P
Product name: HOXA4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human HOXA4 protein.
Gene id: 3201
Gene name: HOXA4
Gene alias: HOX1|HOX1D
Gene description: homeobox A4
Genbank accession: BC160036.1
Immunogen: HOXA4 (AAI60036.1, 1 a.a. ~ 320 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTMSSFLINSNYIEPKFPPFEEYAQHSGSGGADGGPGGGPGYQQPPAPPTQHLPLQQPQLPHAGGGREPTASYYAPRTAREPAYPAAALYPAHGAADTAYPYGYRGGASPGRPPQPEQPPAQAKGPAHGLHASHVLQPQLPPPLQPRAVPPAAPRRCEAAPATPGVPAGGSAPACPLLLADKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI
Protein accession: AAI60036.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003201-B01P-13-15-1.jpg
Application image note: Western Blot analysis of HOXA4 expression in transfected 293T cell line (H00003201-T01) by HOXA4 MaxPab polyclonal antibody.

Lane 1: HOXA4 transfected lysate(35.2 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HOXA4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart