HOXA1 MaxPab rabbit polyclonal antibody (D01) View larger

HOXA1 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXA1 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about HOXA1 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00003198-D01
Product name: HOXA1 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human HOXA1 protein.
Gene id: 3198
Gene name: HOXA1
Gene alias: BSAS|HOX1|HOX1F|MGC45232
Gene description: homeobox A1
Genbank accession: NM_005522.4
Immunogen: HOXA1 (NP_005513.1, 1 a.a. ~ 335 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
Protein accession: NP_005513.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003198-D01-31-15-1.jpg
Application image note: Immunoprecipitation of HOXA1 transfected lysate using anti-HOXA1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HOXA1 purified MaxPab mouse polyclonal antibody (B01P) (H00003198-B01P).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy HOXA1 MaxPab rabbit polyclonal antibody (D01) now

Add to cart