HNMT monoclonal antibody (M04A), clone 2G12 View larger

HNMT monoclonal antibody (M04A), clone 2G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HNMT monoclonal antibody (M04A), clone 2G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HNMT monoclonal antibody (M04A), clone 2G12

Brand: Abnova
Reference: H00003176-M04A
Product name: HNMT monoclonal antibody (M04A), clone 2G12
Product description: Mouse monoclonal antibody raised against a partial recombinant HNMT.
Clone: 2G12
Isotype: IgG Mix Kappa
Gene id: 3176
Gene name: HNMT
Gene alias: HMT|HNMT-S1|HNMT-S2
Gene description: histamine N-methyltransferase
Genbank accession: NM_006895
Immunogen: HNMT (NP_008826, 184 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Protein accession: NP_008826
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003176-M04A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HNMT monoclonal antibody (M04A), clone 2G12 now

Add to cart