HNMT polyclonal antibody (A01) View larger

HNMT polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HNMT polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HNMT polyclonal antibody (A01)

Brand: Abnova
Reference: H00003176-A01
Product name: HNMT polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant HNMT.
Gene id: 3176
Gene name: HNMT
Gene alias: HMT|HNMT-S1|HNMT-S2
Gene description: histamine N-methyltransferase
Genbank accession: BC005907
Immunogen: HNMT (AAH05907, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRYQNCC
Protein accession: AAH05907
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003176-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.72 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HNMT polyclonal antibody (A01) now

Add to cart