HNF4A monoclonal antibody (M07), clone 3C6 View larger

HNF4A monoclonal antibody (M07), clone 3C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HNF4A monoclonal antibody (M07), clone 3C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about HNF4A monoclonal antibody (M07), clone 3C6

Brand: Abnova
Reference: H00003172-M07
Product name: HNF4A monoclonal antibody (M07), clone 3C6
Product description: Mouse monoclonal antibody raised against a partial recombinant HNF4A.
Clone: 3C6
Isotype: IgG2a Kappa
Gene id: 3172
Gene name: HNF4A
Gene alias: FLJ39654|HNF4|HNF4a7|HNF4a8|HNF4a9|MODY|MODY1|NR2A1|NR2A21|TCF|TCF14
Gene description: hepatocyte nuclear factor 4, alpha
Genbank accession: NM_000457
Immunogen: HNF4A (NP_000448, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
Protein accession: NP_000448
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003172-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003172-M07-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HNF4A monoclonal antibody (M07), clone 3C6 now

Add to cart