Brand: | Abnova |
Reference: | H00003170-M09 |
Product name: | FOXA2 monoclonal antibody (M09), clone 4C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXA2. |
Clone: | 4C5 |
Isotype: | IgG1 Kappa |
Gene id: | 3170 |
Gene name: | FOXA2 |
Gene alias: | HNF3B|MGC19807|TCF3B |
Gene description: | forkhead box A2 |
Genbank accession: | NM_021784 |
Immunogen: | FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS |
Protein accession: | NP_068556 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FOXA2 monoclonal antibody (M09), clone 4C5 Western Blot analysis of FOXA2 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |