FOXA2 monoclonal antibody (M05), clone 6G9 View larger

FOXA2 monoclonal antibody (M05), clone 6G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXA2 monoclonal antibody (M05), clone 6G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FOXA2 monoclonal antibody (M05), clone 6G9

Brand: Abnova
Reference: H00003170-M05
Product name: FOXA2 monoclonal antibody (M05), clone 6G9
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXA2.
Clone: 6G9
Isotype: IgG1 Kappa
Gene id: 3170
Gene name: FOXA2
Gene alias: HNF3B|MGC19807|TCF3B
Gene description: forkhead box A2
Genbank accession: NM_021784
Immunogen: FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Protein accession: NP_068556
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003170-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003170-M05-1-12-1.jpg
Application image note: FOXA2 monoclonal antibody (M05), clone 6G9 Western Blot analysis of FOXA2 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXA2 monoclonal antibody (M05), clone 6G9 now

Add to cart