Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FOXA2 monoclonal antibody (M01), clone 7E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
More info about FOXA2 monoclonal antibody (M01), clone 7E6
| Brand: | Abnova |
| Reference: | H00003170-M01 |
| Product name: | FOXA2 monoclonal antibody (M01), clone 7E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXA2. |
| Clone: | 7E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3170 |
| Gene name: | FOXA2 |
| Gene alias: | HNF3B|MGC19807|TCF3B |
| Gene description: | forkhead box A2 |
| Genbank accession: | NM_021784 |
| Immunogen: | FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS |
| Protein accession: | NP_068556 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FOXA2 monoclonal antibody (M01), clone 7E6 Western Blot analysis of FOXA2 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Tumour resistance in induced pluripotent stem cells derived from naked mole-rats.Miyawaki S, Kawamura Y, Oiwa Y, Shimizu A, Hachiya T, Bono H, Koya I, Okada Y, Kimura T, Tsuchiya Y, Suzuki S, Onishi N, Kuzumaki N, Matsuzaki Y, Narita M, Ikeda E, Okanoya K, Seino K, Saya H, Okano H, Miura K. Nat Commun. 2016 May 10;7:11471. |