FOXA2 polyclonal antibody (A01) View larger

FOXA2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXA2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FOXA2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003170-A01
Product name: FOXA2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FOXA2.
Gene id: 3170
Gene name: FOXA2
Gene alias: HNF3B|MGC19807|TCF3B
Gene description: forkhead box A2
Genbank accession: NM_021784
Immunogen: FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Protein accession: NP_068556
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003170-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXA2 polyclonal antibody (A01) now

Add to cart