FOXA1 monoclonal antibody (M05), clone 3C1 View larger

FOXA1 monoclonal antibody (M05), clone 3C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXA1 monoclonal antibody (M05), clone 3C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,ELISA,WB-Re

More info about FOXA1 monoclonal antibody (M05), clone 3C1

Brand: Abnova
Reference: H00003169-M05
Product name: FOXA1 monoclonal antibody (M05), clone 3C1
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXA1.
Clone: 3C1
Isotype: IgG1 Kappa
Gene id: 3169
Gene name: FOXA1
Gene alias: HNF3A|MGC33105|TCF3A
Gene description: forkhead box A1
Genbank accession: NM_004496
Immunogen: FOXA1 (NP_004487, 367 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Protein accession: NP_004487
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003169-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003169-M05-3-33-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.5 ug/ml]
Applications: WB-Ce,IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXA1 monoclonal antibody (M05), clone 3C1 now

Add to cart