Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HMX2 monoclonal antibody (M07A), clone 1B10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HMX2 monoclonal antibody (M07A), clone 1B10
| Brand: | Abnova |
| Reference: | H00003167-M07A |
| Product name: | HMX2 monoclonal antibody (M07A), clone 1B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HMX2. |
| Clone: | 1B10 |
| Isotype: | IgG2a |
| Gene id: | 3167 |
| Gene name: | HMX2 |
| Gene alias: | H6L|Nkx5-2 |
| Gene description: | H6 family homeobox 2 |
| Genbank accession: | NM_005519 |
| Immunogen: | HMX2 (NP_005510, 125 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT |
| Protein accession: | NP_005510 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |