Brand: | Abnova |
Reference: | H00003167-M07 |
Product name: | HMX2 monoclonal antibody (M07), clone 1B10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HMX2. |
Clone: | 1B10 |
Isotype: | IgG2a Kappa |
Gene id: | 3167 |
Gene name: | HMX2 |
Gene alias: | H6L|Nkx5-2 |
Gene description: | H6 family homeobox 2 |
Genbank accession: | NM_005519 |
Immunogen: | HMX2 (NP_005510, 125 a.a. ~ 224 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT |
Protein accession: | NP_005510 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to HMX2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |