Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HMGA1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about HMGA1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00003159-B01P |
| Product name: | HMGA1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human HMGA1 protein. |
| Gene id: | 3159 |
| Gene name: | HMGA1 |
| Gene alias: | HMG-R|HMGA1A|HMGIY|MGC12816|MGC4242|MGC4854 |
| Gene description: | high mobility group AT-hook 1 |
| Genbank accession: | BC004924 |
| Immunogen: | HMGA1 (AAH04924, 1 a.a. ~ 96 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ |
| Protein accession: | AAH04924 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HMGA1 expression in transfected 293T cell line (H00003159-T01) by HMGA1 MaxPab polyclonal antibody. Lane 1: HMGA1 transfected lysate(10.56 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Differential expression and prognostic value of HMGA1 in pancreatic head and periampullary cancer.van der Zee JA, Ten Hagen TL, Hop WC, van Dekken H, Dicheva BM, Seynhaeve AL, Koning GA, Eggermont AM, van Eijck CH. Eur J Cancer. 2010 Aug 17. [Epub ahead of print] |