HMGCS2 monoclonal antibody (M06), clone 1E9 View larger

HMGCS2 monoclonal antibody (M06), clone 1E9

H00003158-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HMGCS2 monoclonal antibody (M06), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about HMGCS2 monoclonal antibody (M06), clone 1E9

Brand: Abnova
Reference: H00003158-M06
Product name: HMGCS2 monoclonal antibody (M06), clone 1E9
Product description: Mouse monoclonal antibody raised against a partial recombinant HMGCS2.
Clone: 1E9
Isotype: IgG2a Kappa
Gene id: 3158
Gene name: HMGCS2
Gene alias: -
Gene description: 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)
Genbank accession: NM_005518
Immunogen: HMGCS2 (NP_005509.1, 424 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV
Protein accession: NP_005509.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003158-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.09 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003158-M06-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged HMGCS2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HMGCS2 monoclonal antibody (M06), clone 1E9 now

Add to cart