H00003148-M06A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003148-M06A |
Product name: | HMGB2 monoclonal antibody (M06A), clone 3F2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant HMGB2. |
Clone: | 3F2 |
Isotype: | IgG Mix Kappa |
Gene id: | 3148 |
Gene name: | HMGB2 |
Gene alias: | HMG2 |
Gene description: | high-mobility group box 2 |
Genbank accession: | BC000903 |
Immunogen: | HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE |
Protein accession: | AAH00903.2 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (47.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | HMGB2 monoclonal antibody (M06A), clone 3F2. Western Blot analysis of HMGB2 expression in Hela S3 NE. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |