HMGB2 monoclonal antibody (M06A), clone 3F2 View larger

HMGB2 monoclonal antibody (M06A), clone 3F2

H00003148-M06A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HMGB2 monoclonal antibody (M06A), clone 3F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about HMGB2 monoclonal antibody (M06A), clone 3F2

Brand: Abnova
Reference: H00003148-M06A
Product name: HMGB2 monoclonal antibody (M06A), clone 3F2
Product description: Mouse monoclonal antibody raised against a full-length recombinant HMGB2.
Clone: 3F2
Isotype: IgG Mix Kappa
Gene id: 3148
Gene name: HMGB2
Gene alias: HMG2
Gene description: high-mobility group box 2
Genbank accession: BC000903
Immunogen: HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Protein accession: AAH00903.2
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003148-M06A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003148-M06A-1-25-1.jpg
Application image note: HMGB2 monoclonal antibody (M06A), clone 3F2. Western Blot analysis of HMGB2 expression in Hela S3 NE.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HMGB2 monoclonal antibody (M06A), clone 3F2 now

Add to cart