Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HMGB2 monoclonal antibody (M03), clone 3C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about HMGB2 monoclonal antibody (M03), clone 3C7
| Brand: | Abnova |
| Reference: | H00003148-M03 |
| Product name: | HMGB2 monoclonal antibody (M03), clone 3C7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HMGB2. |
| Clone: | 3C7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3148 |
| Gene name: | HMGB2 |
| Gene alias: | HMG2 |
| Gene description: | high-mobility group box 2 |
| Genbank accession: | BC000903 |
| Immunogen: | HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE |
| Protein accession: | AAH00903.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HMGB2 monoclonal antibody (M03), clone 3C7 Western Blot analysis of HMGB2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Overexpression of HMGB2 is associated with tumor aggressiveness and prognosis of hepatocellular carcinoma.Kwon JH, Kim J, Park JY, Hong SM, Park CW, Hong SJ, Park SY, Choi YJ, Do I, Joh JW, Kim DS, Choi KY. Clin Cancer Res. 2010 Sep 17. [Epub ahead of print] |