HMGB1 monoclonal antibody (M06), clone 1D9 View larger

HMGB1 monoclonal antibody (M06), clone 1D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HMGB1 monoclonal antibody (M06), clone 1D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about HMGB1 monoclonal antibody (M06), clone 1D9

Brand: Abnova
Reference: H00003146-M06
Product name: HMGB1 monoclonal antibody (M06), clone 1D9
Product description: Mouse monoclonal antibody raised against a full length recombinant HMGB1.
Clone: 1D9
Isotype: IgG2a Kappa
Gene id: 3146
Gene name: HMGB1
Gene alias: DKFZp686A04236|HMG1|HMG3|SBP-1
Gene description: high-mobility group box 1
Genbank accession: BC003378
Immunogen: HMGB1 (AAH03378.1, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Protein accession: AAH03378.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003146-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.39 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003146-M06-13-15-1.jpg
Application image note: Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M06), clone 1D9.

Lane 1: HMGB1 transfected lysate(24.9 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HMGB1 monoclonal antibody (M06), clone 1D9 now

Add to cart