Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003146-M05 |
Product name: | HMGB1 monoclonal antibody (M05), clone 1D10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HMGB1. |
Clone: | 1D10 |
Isotype: | IgG2a Kappa |
Gene id: | 3146 |
Gene name: | HMGB1 |
Gene alias: | DKFZp686A04236|HMG1|HMG3|SBP-1 |
Gene description: | high-mobility group box 1 |
Genbank accession: | BC003378 |
Immunogen: | HMGB1 (AAH03378.1, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Protein accession: | AAH03378.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (49.39 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M05), clone 1D10. Lane 1: HMGB1 transfected lysate(24.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |