HMGB1 monoclonal antibody (M03), clone 1B11 View larger

HMGB1 monoclonal antibody (M03), clone 1B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HMGB1 monoclonal antibody (M03), clone 1B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about HMGB1 monoclonal antibody (M03), clone 1B11

Brand: Abnova
Reference: H00003146-M03
Product name: HMGB1 monoclonal antibody (M03), clone 1B11
Product description: Mouse monoclonal antibody raised against a full length recombinant HMGB1.
Clone: 1B11
Isotype: IgG2a Kappa
Gene id: 3146
Gene name: HMGB1
Gene alias: DKFZp686A04236|HMG1|HMG3|SBP-1
Gene description: high-mobility group box 1
Genbank accession: BC003378
Immunogen: HMGB1 (AAH03378.1, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Protein accession: AAH03378.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003146-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.39 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003146-M03-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Anti-Inflammatory Effects of Hyperoside in Human Endothelial Cells and in Mice.Ku SK, Zhou W, Lee W, Han MS, Na M, Bae JS
Inflammation. 2015 Apr;38(2):784-99. doi: 10.1007/s10753-014-9989-8.

Reviews

Buy HMGB1 monoclonal antibody (M03), clone 1B11 now

Add to cart