HMBS monoclonal antibody (M02), clone 2B12 View larger

HMBS monoclonal antibody (M02), clone 2B12

H00003145-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HMBS monoclonal antibody (M02), clone 2B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about HMBS monoclonal antibody (M02), clone 2B12

Brand: Abnova
Reference: H00003145-M02
Product name: HMBS monoclonal antibody (M02), clone 2B12
Product description: Mouse monoclonal antibody raised against a full-length recombinant HMBS.
Clone: 2B12
Isotype: IgG2a Kappa
Gene id: 3145
Gene name: HMBS
Gene alias: PBG-D|PBGD|UPS
Gene description: hydroxymethylbilane synthase
Genbank accession: BC000520
Immunogen: HMBS (AAH00520.1, 1 a.a. ~ 361 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKIPDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLNDAH
Protein accession: AAH00520.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003145-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged HMBS is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy HMBS monoclonal antibody (M02), clone 2B12 now

Add to cart