HMBS monoclonal antibody (M01), clone 3E8 View larger

HMBS monoclonal antibody (M01), clone 3E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HMBS monoclonal antibody (M01), clone 3E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about HMBS monoclonal antibody (M01), clone 3E8

Brand: Abnova
Reference: H00003145-M01
Product name: HMBS monoclonal antibody (M01), clone 3E8
Product description: Mouse monoclonal antibody raised against a full length recombinant HMBS.
Clone: 3E8
Isotype: IgG2a Kappa
Gene id: 3145
Gene name: HMBS
Gene alias: PBG-D|PBGD|UPS
Gene description: hydroxymethylbilane synthase
Genbank accession: BC000520
Immunogen: HMBS (AAH00520.1, 1 a.a. ~ 361 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKIPDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLNDAH
Protein accession: AAH00520.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003145-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (65.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003145-M01-13-15-1.jpg
Application image note: Western Blot analysis of HMBS expression in transfected 293T cell line by HMBS monoclonal antibody (M01), clone 3E8.

Lane 1: HMBS transfected lysate(39.71 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HMBS monoclonal antibody (M01), clone 3E8 now

Add to cart