MR1 monoclonal antibody (M04), clone 5B5 View larger

MR1 monoclonal antibody (M04), clone 5B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MR1 monoclonal antibody (M04), clone 5B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about MR1 monoclonal antibody (M04), clone 5B5

Brand: Abnova
Reference: H00003140-M04
Product name: MR1 monoclonal antibody (M04), clone 5B5
Product description: Mouse monoclonal antibody raised against a partial recombinant MR1.
Clone: 5B5
Isotype: IgG1 Kappa
Gene id: 3140
Gene name: MR1
Gene alias: HLALS
Gene description: major histocompatibility complex, class I-related
Genbank accession: NM_001531
Immunogen: MR1 (NP_001522, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
Protein accession: NP_001522
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003140-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003140-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MR1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MR1 monoclonal antibody (M04), clone 5B5 now

Add to cart