Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HLF monoclonal antibody (M04), clone M2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about HLF monoclonal antibody (M04), clone M2
| Brand: | Abnova |
| Reference: | H00003131-M04 |
| Product name: | HLF monoclonal antibody (M04), clone M2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HLF. |
| Clone: | M2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3131 |
| Gene name: | HLF |
| Gene alias: | MGC33822 |
| Gene description: | hepatic leukemia factor |
| Genbank accession: | BC036093 |
| Immunogen: | HLF (AAH36093, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL |
| Protein accession: | AAH36093 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (58.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HLF expression in transfected 293T cell line by HLF monoclonal antibody (M04), clone M2. Lane 1: HLF transfected lysate(33.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Circadian clock-controlled intestinal expression of the multidrug resistance gene mdr1a in mice.Murakami Y, Higashi Y, Matsunaga N, Koyanagi S, Ohdo S. Gastroenterology. 2008 Nov;135(5):1636-1644.e3. Epub 2008 Aug 3. |