Brand: | Abnova |
Reference: | H00003126-M01A |
Product name: | HLA-DRB4 monoclonal antibody (M01A), clone 4C8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant HLA-DRB4. |
Clone: | 4C8 |
Isotype: | IgG2b Kappa |
Gene id: | 3126 |
Gene name: | HLA-DRB4 |
Gene alias: | DRB4|HLA-DR4B |
Gene description: | major histocompatibility complex, class II, DR beta 4 |
Genbank accession: | BC005312 |
Immunogen: | HLA-DRB4 (AAH05312, 30 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GDTQPRFLEQAKCECRFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS |
Protein accession: | AAH05312 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (51.81 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HLA-DRB4 monoclonal antibody (M01A), clone 4C8. Western Blot analysis of HLA-DRB4 expression in human kidney. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |