Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HLA-DRB3 MaxPab mouse polyclonal antibody (B02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr,Flow Cyt |
More info about HLA-DRB3 MaxPab mouse polyclonal antibody (B02)
| Brand: | Abnova |
| Reference: | H00003125-B02 |
| Product name: | HLA-DRB3 MaxPab mouse polyclonal antibody (B02) |
| Product description: | Mouse polyclonal antibody raised against a full-length human HLA-DRB3 protein. |
| Gene id: | 3125 |
| Gene name: | HLA-DRB3 |
| Gene alias: | HLA-DR3B|MGC117330 |
| Gene description: | major histocompatibility complex, class II, DR beta 3 |
| Genbank accession: | NM_022555 |
| Immunogen: | HLA-DRB3 (NP_072049, 1 a.a. ~ 266 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS |
| Protein accession: | NP_072049 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HLA-DRB3 expression in transfected 293T cell line (H00003125-T01) by HLA-DRB3 MaxPab polyclonal antibody. Lane 1: HLA-DRB3 transfected lysate(29.26 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr,Flow Cyt |
| Shipping condition: | Dry Ice |