HLA-DQB1 monoclonal antibody (M02), clone 1G6 View larger

HLA-DQB1 monoclonal antibody (M02), clone 1G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HLA-DQB1 monoclonal antibody (M02), clone 1G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HLA-DQB1 monoclonal antibody (M02), clone 1G6

Brand: Abnova
Reference: H00003119-M02
Product name: HLA-DQB1 monoclonal antibody (M02), clone 1G6
Product description: Mouse monoclonal antibody raised against a partial recombinant HLA-DQB1.
Clone: 1G6
Isotype: IgG2b Kappa
Gene id: 3119
Gene name: HLA-DQB1
Gene alias: CELIAC1|HLA-DQB|IDDM1
Gene description: major histocompatibility complex, class II, DQ beta 1
Genbank accession: BC012106.1
Immunogen: HLA-DQB1 (AAH12106.1, 129 a.a. ~ 217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPII
Protein accession: AAH12106.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003119-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003119-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged HLA-DQB1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HLA-DQB1 monoclonal antibody (M02), clone 1G6 now

Add to cart