Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003109-M06A |
Product name: | HLA-DMB monoclonal antibody (M06A), clone 5G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HLA-DMB. |
Clone: | 5G11 |
Isotype: | IgG2b Kappa |
Gene id: | 3109 |
Gene name: | HLA-DMB |
Gene alias: | D6S221E|RING7 |
Gene description: | major histocompatibility complex, class II, DM beta |
Genbank accession: | NM_002118 |
Immunogen: | HLA-DMB (NP_002109, 22 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE |
Protein accession: | NP_002109 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HLA-DMB expression in transfected 293T cell line by HLA-DMB monoclonal antibody (M06A), clone 5G11. Lane 1: HLA-DMB transfected lysate(28.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |