HLA-DMB monoclonal antibody (M06A), clone 5G11 View larger

HLA-DMB monoclonal antibody (M06A), clone 5G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HLA-DMB monoclonal antibody (M06A), clone 5G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about HLA-DMB monoclonal antibody (M06A), clone 5G11

Brand: Abnova
Reference: H00003109-M06A
Product name: HLA-DMB monoclonal antibody (M06A), clone 5G11
Product description: Mouse monoclonal antibody raised against a partial recombinant HLA-DMB.
Clone: 5G11
Isotype: IgG2b Kappa
Gene id: 3109
Gene name: HLA-DMB
Gene alias: D6S221E|RING7
Gene description: major histocompatibility complex, class II, DM beta
Genbank accession: NM_002118
Immunogen: HLA-DMB (NP_002109, 22 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE
Protein accession: NP_002109
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003109-M06A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003109-M06A-13-15-1.jpg
Application image note: Western Blot analysis of HLA-DMB expression in transfected 293T cell line by HLA-DMB monoclonal antibody (M06A), clone 5G11.

Lane 1: HLA-DMB transfected lysate(28.9 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HLA-DMB monoclonal antibody (M06A), clone 5G11 now

Add to cart