Brand: | Abnova |
Reference: | H00003109-M05 |
Product name: | HLA-DMB monoclonal antibody (M05), clone 5F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HLA-DMB. |
Clone: | 5F3 |
Isotype: | IgG2b Kappa |
Gene id: | 3109 |
Gene name: | HLA-DMB |
Gene alias: | D6S221E|RING7 |
Gene description: | major histocompatibility complex, class II, DM beta |
Genbank accession: | NM_002118 |
Immunogen: | HLA-DMB (NP_002109, 22 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE |
Protein accession: | NP_002109 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HLA-DMB is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |