HK2 (Human) Recombinant Protein (Q01) View larger

HK2 (Human) Recombinant Protein (Q01)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HK2 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about HK2 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00003099-Q01
Product name: HK2 (Human) Recombinant Protein (Q01)
Product description: Human HK2 partial ORF ( AAH21116, 818 a.a. - 917 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 3099
Gene name: HK2
Gene alias: DKFZp686M1669|HKII|HXK2
Gene description: hexokinase 2
Genbank accession: BC021116
Immunogen sequence/protein sequence: IVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR
Protein accession: AAH21116
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00003099-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Expression and role in glycolysis of human ADP-dependent glucokinase.Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR.
Mol Cell Biochem. 2012 Jan 5. [Epub ahead of print]

Reviews

Buy HK2 (Human) Recombinant Protein (Q01) now

Add to cart