Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HK2 monoclonal antibody (M01), clone 4H1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about HK2 monoclonal antibody (M01), clone 4H1
| Brand: | Abnova |
| Reference: | H00003099-M01 |
| Product name: | HK2 monoclonal antibody (M01), clone 4H1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HK2. |
| Clone: | 4H1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3099 |
| Gene name: | HK2 |
| Gene alias: | DKFZp686M1669|HKII|HXK2 |
| Gene description: | hexokinase 2 |
| Genbank accession: | BC021116 |
| Immunogen: | HK2 (AAH21116, 818 a.a. ~ 917 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR |
| Protein accession: | AAH21116 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | HK2 monoclonal antibody (M01), clone 4H1. Western Blot analysis of HK2 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Expression and role in glycolysis of human ADP-dependent glucokinase.Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR. Mol Cell Biochem. 2012 Jan 5. [Epub ahead of print] |